PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001891.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 378aa    MW: 42531.5 Da    PI: 4.8891
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001891.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.34.3e-55281551128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdee++ +yL +kv+++ + +  +i evd++kvePwdLpkk+k +ekew+fF++rd+ky+tg r+nrat+sgyWkat
  Itr_sc001891.1_g00004.1  28 LPPGFRFHPTDEEIILHYLLEKVANNGFVA-IAIGEVDLNKVEPWDLPKKAKMGEKEWWFFCQRDRKYPTGMRTNRATESGYWKAT 112
                              79*************************988.88***************99999********************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkdke+++  ++ l+g+kktLvfy+grapkgek++Wvmheyrl
  Itr_sc001891.1_g00004.1 113 GKDKEIFKGkSNILIGMKKTLVFYRGRAPKGEKSNWVMHEYRL 155
                              *******9745556***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6325178IPR003441NAC domain
PROSITE profilePS5100558.10828178IPR003441NAC domain
PfamPF023651.3E-2829155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
METLETGKEA LVGQGVENER DKDDLLGLPP GFRFHPTDEE IILHYLLEKV ANNGFVAIAI  60
GEVDLNKVEP WDLPKKAKMG EKEWWFFCQR DRKYPTGMRT NRATESGYWK ATGKDKEIFK  120
GKSNILIGMK KTLVFYRGRA PKGEKSNWVM HEYRLDGQFS YSKTIRDAEW VVSRVFHKSA  180
GVVRGIPMEN NDNHHQMDSF VDNLIHSPSV AAATTTTTLP SLRDLSPASN QNYFLENDDD  240
NQDFKPVMAS SSHGKSPYFP ITYPYSQILP AAAAPVFNNG LFYSPFLPNS PALKMEQTSY  300
NNVSGSQETG LSMEVMMPAN TETTSALSKL KQIIATDDQS SPRPFDDLDA DPSYHDGDMD  360
DHLDPYSFWD DYGGPADP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-51151792169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492652.12e-96PREDICTED: NAC domain-containing protein 100-like
TrEMBLA0A0D2SKF92e-96A0A0D2SKF9_G
TrEMBLU5IJP42e-96U5IJP4_G
STRINGVIT_08s0007g07640.t017e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.13e-95Arabidopsis NAC domain containing protein 87